Quantcast
Channel: Post Feed
Browsing all 41826 articles
Browse latest View live

Ngs Multi-Dataset Analysis

Hello I have some doubts on my analysis of an 454 EST s assembly of data that come from 3 different datasets. Each dataset come from the same organism, but in different conditions (resistance to...

View Article


Batch Blast Two Sequences And Output Sequence Alignment

Dear all,I want to compare a number of sequences with another list of sequences. Each comparison is consisted of only two sequences. I make an example below.FILE1>gene1_species1...

View Article


Usage Of Format Specifiers For Blastx In Ncbi Standalone Blast

Hi to all I am doing blastx with ncbi standalone blast for large number of sequences. I am getting the output in outfmt -7 (tabular with comment lines). There are 'keywords' like frames/qframe/sframe...

View Article

How To Blast Consensus Sequences With Bacterial Genome?

Dear all,Subject- To find number of hits available for the particular consensus sequence in bacterial genomeI am having this consensus...

View Article

The Meaning Of The E In Blast Output

I have a question that's been floating around in my head for a while, and a colleague recently asked the same thing so I thought I should finally get to the bottom of it.What does the 'e' in the output...

View Article


How To Concatenate Blast Results (M8) Via Setting Threshold Of Distance...

hi, dear guysI performance blastn (-m 8) using a query file of many sequences, and for each query sequence, the output contains many fragmental hits of significance. however, these hits have no...

View Article

What Exactly Does Formatdb Do?

As far as I know, the blast searches for homology in the way that indexing query(word list), scan database(automaton), extension and so on. Then why should we pre-process the database with formatdb.I...

View Article

Psiblast Warning: Composition-Based Score Adjustment

Warning: lcl|Query_1 1DCH:A|PDBID|CHAIN|SEQUENCE: Warning: Composition-based score adjustment conditioned on sequence properties and unconditional composition-based score adjustment is not supported...

View Article


Why Does Blastdbcmd Produce The Error: Oid Not Found

hI,,,I am trying to extract fasta sequences from a local db using blastcmd command (NCBI BLAST) as follows blastdbcmd -db blastdb/9311 -dbtype prot -entry_batch 93hmmsearchacc.txt -out vivien.fastaFor...

View Article


Blast Xml Document Iterations

When running BLAST with one sequence against a sequence database there is only one iteration in the <Iteration> element, as in the value of Iteration_iter-num is one. For example:<?xml...

View Article

Biopython: Executing Blast On Custom Db

Ok, so I am using the NcbiblastxCommandline wrapper to execute a BLAST search on a custom database. cline = NcbiblastxCommandline(cmd='blastx', query=temp_path, out=blast_path, subject=path, outfmt=5,...

View Article

How To Get Status Update In Ncbi Standalone Blast?

For example, I am running standalone Blast+ for thousands of EST sequences with remote (NCBI) server. I am not getting any status message like 15 of 100 sequence is running. Is it possible to get any...

View Article

Protein Sequence Alignment

I want to know how to call Blast from java code, I have wildtype residue, mutant residue, position of mutation, and protein sequenceI want to calculate the frequency of wildtype residue, mutant...

View Article


Different blast results between CLCBio and local blast

Hi,I've been using CLCBio to blast assembled contigs, but it's really slow. I decided to try setting up a local blast database and using that to blast my contigs, but I'm getting different results even...

View Article

Compare Two Protein Sequences Using Local Blast

Hi,I have been given a task to compare the all the protein sequences of a strain of campylobacter with a strain of E.coli. I would like to do this locally using Biopython and the inbuilt Blast tools....

View Article


Building Protein Models From Tblastn Tabular Format

Hi,I have done tblastn and now I have a blast tabular output format for proteins. Each hit has this informationqueryId, subjectId, percIdentity, alnLength, mismatchCount, gapOpenCount, queryStart,...

View Article

BLASTP many pairs of peptide sequences

Dear all,I have many pairs of protein sequences, an example shown below.MDDDIAALVVDNGSGMCKAG  DDDIAALVDNSGSMCKAGTTAEREIVRDIKEKLCY  TTAEIVRKEKLCYVARMQKEITAPSTMKIKI  KEITALPSTMKIKII... ...I need to...

View Article


Quick Command To Split Large Blastx Files?

Any thoughts? I have large 7 gb files as resulted from Blastx any clue how to split them?Edit:These are standard blastX files (fasta). I need to split them for a program (binning) call SOrt-ITEMS/MEGAN

View Article

How To Search Blast With Ensg Id'S?

I have some ENSG id's and I would like to search BLAST database with this id's. When I use the ENSG id's directly, BLAST cannot find any genes. I think I need to convert the ENSG id's to some other...

View Article

Comparing Blast M8 Outputs

Hi,I want to compare BLAST outputs in m8 format to find out if any queries in the separate output files have the same subject hits to NCBI nr database.For example, for the 2 BLAST outputs in m8 format...

View Article
Browsing all 41826 articles
Browse latest View live