Quantcast
Channel: Post Feed
Browsing all 41826 articles
Browse latest View live
↧

Make A Custom Blast Library Using The Output Of Another Blast Result

Hi Biostar,I am working on a microbial gene annotation project and I am interested in taking a large number of sequences (say 20,000) and blasting them against the NR database. However, even with a...

View Article


Error in run blastpgp

Hi, I am trying to have the command line blast work, however, I did not manage to execute it properly. I would appreciate if you can tell me what I am doing wrong. So here are the things I did so far:...

View Article


Distribution of e-values in Best Reciprocal Blast Hits for Ortholog Mining

Does anyone have an idea of how the distribution of expect values will look when using reciprocal blast to detect orthologs?

View Article

BLASTP many pairs of peptide sequences

Dear all,I have many pairs of protein sequences, an example shown below.MDDDIAALVVDNGSGMCKAG  DDDIAALVDNSGSMCKAGTTAEREIVRDIKEKLCY  TTAEIVRKEKLCYVARMQKEITAPSTMKIKI  KEITALPSTMKIKII... ...I need to...

View Article

Online Tools To "Prettify" Blast Output

Can anyone suggest an online tool, for a non-bioinformatician (not for me you understand, oh no not me), that will make BLAST output "pretty", i.e. add shading to make mismatches and so on more...

View Article


Blastn / Tblastn : Mapping The Features Of The Query To The Hit.

I'm blasting+ (blastn+ or tblastn) an annotated sequence (a Genbank.xml sequence (nucleotide or protein) or an Uniprot.xml entry) against a DNA database.Is there a standard tool to map the features of...

View Article

Scientific Names In Blast Output And Databases

Hi, I'm interested in getting the scientific names of my blast hits ran locally. I see blast+ search apps have option -outfmt which can take sscinames(seems new in version Blast+ 2.2.28), but even...

View Article

blastn -no_greedy switch

Does setting the -no_greedy switch make blastn behave like Smith-Waterman? The documentation states that the switch allows blast to "use non-greedy dynamic programming extension". It isn't clear to me...

View Article


How I Can Find The Sequence For The Gene That I Want To Synthesize?

Hi,I'm starting with bioinformatic, and i want ask u this question:I have this sequence: vpnvrgmgar davylmekrg ikvritgrgr vieqslapgd kikngmqcsl rlg from "penicillin-binding protein dimerization domain...

View Article


Strange Behaviour Of Bioperl'S Bio::Searchio When Parsing Xml Blast Output

Hello, I've noticed some strange behaviour when parsing BLAST .xml output files (-oufmt 5) using BioPerl's Bio::SearchIO library. I have a simple parser script that looks something like:...

View Article

Running Blast For A List Of Pairs

Hi,I would like to ask if it is possible that I run BLAST with a list of pairs of query and reference sequence IDs?I tried bl2seq but unfortunately it does not produce the alignment of the whole...

View Article

Obtaining the top matches from blast

Hi,I have downloaded the current version of the stand-alone-blast (ncbi-blast-2.2.29+) and I am trying to use blast (blastn) to find similarity of of a group of nucleotide sequences that I have....

View Article

Mysterious Lost Version Of Blast (2.2.20)

Some people in my lab use megablast from BLAST 2.2.20 claiming that it is magically faster than the latest.So I went to search for it to see what the difference is:...Deep in the dungeons of NCBI>...

View Article


Blastdbcheck Error

I keep getting errors on the following command:blastdbcheck -db nt.00Writing messages to <stdout> at verbosity (Summary) ISAM testing is ENABLED. Legacy testing is DISABLED. By default, testing...

View Article

How To Create A Pssm From Fasta Homologues With Ncbi Blast+ 2.2.23

I have a FASTA sequence file with about 10 homologous proteins. What I would like to do is create a PSSM from them and use it to search a transcriptome database.But how to create it? There is a makemat...

View Article


de novo RNA-seq and different assembly options

Hi all -- I'm new to RNA-seq and have had some issues assembling the reads. I'm looking for any advice or input on what might be the best way to handle my data. My work is done in oocytes of a...

View Article

blast output for FASTA (aligned sequences) to get organism name

Hi,I want to get the organism name from blast output (FASTA (aligned sequences)) for the specific protein.I am a beginner in python. Please help me to write the script for getting organism name in...

View Article


Looking For Frequency Of A Very Specific Rna Editing Event In Publicly...

I am working on a ubiquitously and well expressed gene whose ~1.5 kb-sized transcripts get mutated at one and only one site. The mutation is a nonsense one that changes an ORF codon of the mRNA to a...

View Article

Exact Matching With Bowtie, Blat And Blast+

I am running bowtie with the following parameters, to look for up to, say, 10 exact matches of a 36-base nucleotide string to a GRCh37/hg19 index, _e.g._: $ bowtie -S hg19 -v 0 -k 10 -f sequence.fa...

View Article

Disagreement When Computing Contig Alignments With Different Tools.

Hi everybody I need a small suggestion : After assembly of one listeria genome with "Spades" i want to plot reference genome with my contig file. So i am using Mauve and Quast 2.3 to plot . Now i am...

View Article
Browsing all 41826 articles
Browse latest View live