Quantcast
Channel: Post Feed
Browsing all 41826 articles
Browse latest View live

Python Program Accepting Fasta And Blast, Outputting In Xml Then Returning...

Ok. The assignment was to write a program which accepts an input argument of a FASTA file and prints the hit_id of all found sequences using three functions: run_blast (accepting the FASTA and optional...

View Article


Disagreement When Computing Contig Alignments With Different Tools.

Hi everybody I need a small suggestion : After assembly of one listeria genome with "Spades" i want to plot reference genome with my contig file. So i am using Mauve and Quast 2.3 to plot . Now i am...

View Article


Read Blast Output Directly From Stdout With Bioperl

Hi there,I finally decided myself to try Perl for a project and I got a question concerning BioPerl. I would like to read the result (blastxml) of a blast query directly from STDOUT. Is it possible...

View Article

Alternative To Local Blastplus To Blast 10000'S Sequences On Nr, Swissprot...

Hi,Here is a case scenario that happens quite often to me: I need to blast from 1,000 to 20,000 sequences in order to find the proteins these sequences code for. These sequences come from fish cDNA...

View Article

How To Perform A Blast Search From A Java Application?

Hello everyone,I would like to perform a Blast Search form within a Java application, i.e. I want to submit the query and evaluate the results. I have stumbled upon several jars on the web, but none of...

View Article


recruitment plot - blast output

Hello Guys,Does anyone have a tutorial for generating recruitment plot from a file output blast? thanks!

View Article

Forum: Ncbi Blast Tutorial Video

An introductory discussion on BLAST and using it via the NCBI interfaceClick to go to YouTube

View Article

convert legacy blast parameters to blastn

Hi all,I am following the parameters given in a paper for performing blast.The parameters given are in the old format;  -X 150 -q -1 -F FCould anyone convert them to the current blastn format?eg...

View Article


Batch Blast Two Sequences And Output Sequence Alignment

Dear all,I want to compare a number of sequences with another list of sequences. Each comparison is consisted of only two sequences. I make an example below.FILE1>gene1_species1...

View Article


Blast Db Version

Hi all,I'm currently updating my BLAST application from the legacy BLAST to BLAST+. It seems that BLAST+ expects 'version 4' database files. Which my blast DB's apparently are not.Is there a way to use...

View Article

Have You Ever Tried Megablast Indexation ?

Hi, I am surprised to see as low number of posts about megablast indexing... Is this because it does not work? If I believe this one, this should really help to get results faster. But after some...

View Article

Assigning subject to query based on coverage from blast output file

Dear all, I have blast result in tabulated format. Each of the query hits multiple subject sequences. From all of those hits, I want to assign that subject sequence which covers the query sequence the...

View Article

Methodological process for GO functional annotation of my positively selected...

I did my homework first here and elsewhere but still find it difficult to fit pieces of information I get that would weave a standard methodological workflow enabling me analyze my candidate genes...

View Article


Problem In Making Blast Database (Makeblastdb)

Hello, I am confused by BLAST. This is the problem: I have made a fasta file as following>1|DNA (cytosine-5)-methyltransferase 3A MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPV...

View Article

Psiblast Warning: Composition-Based Score Adjustment

Warning: lcl|Query_1 1DCH:A|PDBID|CHAIN|SEQUENCE: Warning: Composition-based score adjustment conditioned on sequence properties and unconditional composition-based score adjustment is not supported...

View Article


data from SRA against blast databases method.

Hello.I want to find a specific gene inside SRA files and I am wondering if i am using a correct way to align those sequences because its the first time that i am "playing" with something like that.So,...

View Article

Blast "Max Matches In A Query Range" Option

Hi Everyone, This is the first time I'm going to try such a web site to see if it works or not, hope it works!So I have a few questions regarding blast, I appreciate it if you can help me,I see that...

View Article


Problem with blastp when blasting against custom made database

Hello, I have been trying the last days to make my database for blast work but I really don't know how to figure out this problem. Begining from the start of the problem, I want to make a blastp...

View Article

Command to get BlastDB(Blast Database) information

Hi guys, I have a very simple question on how to get the information on the size of BLASTDB created using standalone BLAST. I have created several BLAST databases and now I need information on their...

View Article

Bl2Seq With Multi Fasta

Hello,I have two groups of sequences in separate files (1.fasta and 2.fasta). I need to make comparison between them. However I cannot runbl2seq -i 1.fa -j 2.fa -p blastp -o outputbecause bl2seq is...

View Article
Browsing all 41826 articles
Browse latest View live