Quantcast
Browsing all 41826 articles
Browse latest View live

Any tool to generate protein similarity matrix

Hi, I want to calculate the similarities between each protein pariwise and then implement random walk to predict interactions. A paper mentions "J. Mol. Biol. (1981) 147, 195-197" to compare two...

View Article


Problem With Blastp Of Biopython: Returned Non-Zero Exit Status 1

I want to do a local BLAST using blastp from the Bio.Blast.Applications. However, when I run it I get a runtime error: returned non-zero exit status 1. According to the manual it is Exit Code Meaning:...

View Article


How To Show More Blast Results Using Biopython?

Hi,I'm using biopython to BLAST over the internet. However, it only saves 30 results (there are more than 30 results that are under the e-value I chose) in the xml. I've been looking all over but can't...

View Article

Most Sensitive Method To Search 100-1000Bp Sequences To Genome At Human-Mouse...

Following up on this question: http://biostar.stackexchange.com/questions/8010/searching-200-400bp-matches-against-mammalian-genome-human-mouse-distance I would like to know what is the most sensitive...

View Article

How Can I Sort Blast Output Based On E-Value?

Hello: I have a blast output with about 50000 sequence list. The problem I have is that I need to sort those results based on the smallest e-value to greater e-value. Could you guys please suggest me...

View Article


Help With Formatdb And Blast All

I have my own database of sequences stored in MySQL. I convert this database into a blastable format using formatdb, code below:formatdb -p T -i db.fastaI then do the same with the query sequence and...

View Article

Biojava And Blast+

Dear all, i´m currently trying to parse several blast output files in order to show the results in my software. Since i have to carry out many blast searches from time to time, i decided to install the...

View Article

Assigning subject to query based on coverage from blast output file

Dear all, I have blast result in tabulated format. Each of the query hits multiple subject sequences. From all of those hits, I want to assign that subject sequence which covers the query sequence the...

View Article


How To Automate Primer Blast With Perl?

Hey all!does any one have a PERL script for automating the PRIMER BLAST tool.... i.e. i want a script which will submit my fasta file and parameters to Primer BLAST and retrieve the output. I'm stuck...

View Article


Download Ensembl Blastn Result

Hi,How can I download blast results from ensembl. I blast 10 sequences against all ensembl species. Now I have the result page and I want to download all hits to compare them.Is it possible ?Here's the...

View Article

Help With Rps-Blast With New Blast

HiI want to make rpsblast with the new blast 2.2.25 with rpstblastn. But I need to format the database. I think for the older blast version you use formatrpsdb and it´s create others files including...

View Article

BLAST in Oracle 12c

Hello dear colleagues,BLASTN_MATCH and other BLAST alignments were available in Oracle 10g in Oracle Data Mining (ODM) package.Is there BLAST in 12c?If not, is there a way to install BLAST from 10g to...

View Article

Comparing Blast M8 Outputs

Hi,I want to compare BLAST outputs in m8 format to find out if any queries in the separate output files have the same subject hits to NCBI nr database.For example, for the 2 BLAST outputs in m8 format...

View Article


How to create a Blast database of viruses ?

Hi all,For a metagenomic project a want to make a blast database of viruses. I dont want to blast my reads on the entire nt database. But I dont know how to make it. Downloading the result of a query...

View Article

BLASTP many pairs of peptide sequences

Dear all,I have many pairs of protein sequences, an example shown below.MDDDIAALVVDNGSGMCKAG  DDDIAALVDNSGSMCKAGTTAEREIVRDIKEKLCY  TTAEIVRKEKLCYVARMQKEITAPSTMKIKI  KEITALPSTMKIKII... ...I need to...

View Article


Are old versions of NCBI's nr stored somewhere?

Hello,I'd like to study how NCBI's non-redundant protein database (nr) has developed over the years. However, I'm yet to find a way to download anything but the latest release from the NCBI ftp. Are...

View Article

How To Get Blast+ (Stand Alone Blast) Output To Contain Only The First Hit...

Greetings! I'm using BLAST+ v. 2.2.26, and would like to customize the output to include only the FIRST hit for each separate record in the data base. The region I am using as the query is a domain...

View Article


Blast Two Sequences

Hello all! I have a list of pairs of proteins and I want to compare speed and accuracy of "BLAST Two Sequences" to a Smith-Waterman program for alignment. I know there is a "Blast Two Sequences" option...

View Article

recruitment plot - blast output

Hello Guys,Does anyone have a tutorial for generating recruitment plot from a file output blast? thanks!

View Article

Blast+ Stand Alone Version For Sequence Alignment

HiOn the on line version of Blastp (link text) there is a sequence alignment section (and it produces E-values for the alignment).and now I want to use the standalone version to perform alignment(My...

View Article
Browsing all 41826 articles
Browse latest View live