Quantcast
Browsing all 41826 articles
Browse latest View live

Compute Blastx E-Value

Does anyone know how blastx e-values are computed? Is it the same as blastp, except the query sequence is divided by 3? I've tried using E = (m/3)n2^(-S), but I get slightly different results than from...

View Article


How To Blast Consensus Sequences With Bacterial Genome?

Dear all,Subject- To find number of hits available for the particular consensus sequence in bacterial genomeI am having this consensus...

View Article


How Can I Batch Blast Sequences To Identify Them?

I have a list of 189 Accession numbers for 16s rRNA, how can I batch BLAST these to find which species they are closest too? I tried this server: http://greengene.uml.edu/programs/NCBI_Blast.html but...

View Article

Scientific Names In Blast Output And Databases

Hi, I'm interested in getting the scientific names of my blast hits ran locally. I see blast+ search apps have option -outfmt which can take sscinames(seems new in version Blast+ 2.2.28), but even...

View Article

Retrieving Results Using Blast Soap Api

Hi ; I have a problem with using Blast SOAP API. Previously, I used the downloadable version of blast in which I balstp against PDB using the following command line:"blasp.exe -query input.txt -db...

View Article


Custom Matrices With Ncbi Blast

Does anyone have an idea on how to make NCBI BLAST work with custom Matrices? i.e. ones that are not provided by the BLOSUM series that come as a default with NCBI BLAST.

View Article

What'S The Easiest Way To Blast 5000 Sequences Against An Exon Fragment?

I have 5000 EST sequences that I downloaded from Genbank. I have a 500 bp exon fragment that I'd like to BLAST against this lot of sequences to see if my exon is present or not. What's the easiest way...

View Article

Generating Protein Consensus Sequence For Blast Input

I have a set of 3 protein sequences for which I need to find the "consensus sequence" which can be used as an input to blast against a local database.how should I go about it?

View Article


Problem In Making Blast Database (Makeblastdb)

Hello, I am confused by BLAST. This is the problem: I have made a fasta file as following>1|DNA (cytosine-5)-methyltransferase 3A MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPV...

View Article


Assemble Reads According To Blast Result

Dear all, I performed blast using ~200 gene sequences from reference organism against a draft genome dataset from related species ( containing 12million short reads(sr), each of which is 88bp). The...

View Article

Blast+ Error Code=12

Something really bizarre is going on. I ran 6 tblastn jobs independently using the following command line entry: tblastn -query blastqueries14920.fasta -out blastqueries14920.fasta.out -db...

View Article

Missing BLAST hits - max_hsps and max_target_seqs?

Hi, I have a single file that contains 10,000 query sequences, each 300bp long. The subject is a single chromosome that I have imported into a nucleotide database ("makeblastdb -dbtype nucl"). Due to...

View Article

BLAST: How much of the query is aligned?

At first, I thought this question would answered by the "qcovs" field, but a glance at the results proved that that isn't the case. To begin with, each qcovs value  relates not to the original query,...

View Article


Batch Blast Two Sequences And Output Sequence Alignment

Dear all,I want to compare a number of sequences with another list of sequences. Each comparison is consisted of only two sequences. I make an example below.FILE1>gene1_species1...

View Article

Ways To Quantify Proteome Analysis Via Blast

I'm working on software to allow users to blast an entire proteome against a manually curated database in order to attempt to quantify the composition of that organisms proteins against our database....

View Article


Merging Blastx Hits From Overlapping Bacterial Genome Segments

I blastx-ed 1Mbp bacterial genome fragment against NCBI nr database. I have split it into 2000bp fragments with 500bp overlap into a one multiple fasta file (splitter from EMBOSS) splitter -sequence...

View Article

An Error By Using Ncbi-Blast-2.2.25+ (On Windows)

Hi all I downloaded blast+ software package (for windows), and installed like theBookshelf; to run it i used this "ncbi-blast-2.2.25+/bin/blastn –query text_query.txt –db refseq_genomic –out...

View Article


Pipeline Or Tool For Going From Assembled Genome Fasta & Gff Files Directly...

I'm hoping this doesn't come off as a lazy question, but I am wondering if anyone is aware of a tool or pipeline out there that directly takes reference genome (supercontigs, contigs, scaffold, what...

View Article

Scientific Notation In Blast

Hi there,I've to choose some sequences from blast result which are under 10^-5 Results are in scientific notation. How can I convert scientific notation to double? Which is the double for 2e-104 ?Thank...

View Article

Error Using Makeblastdb

Hi there,I am trying to run makebastdb to create a new BLAST database. The program starts but cuts out abruptly with an Error:Error: ncbi::s_FixBioseqDeltas() - Bioseq must have Seq-data or Delta...

View Article
Browsing all 41826 articles
Browse latest View live