Quantcast
Channel: Post Feed
Viewing all articles
Browse latest Browse all 41826

Changing evalue doesn't change the results of blast

$
0
0
Hi! First's run results occurred by this command : tblastn -query query.fasta -db plant_DB -out output-evalue -html and in some reads i got two targets. e.g : Score = 160 bits (404), Expect = 1e-44, Method: Composition-based stats. Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%) Frame = +3 Query 1016 GLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV 1075 GLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV Sbjct 3 GLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTV 182 Query 1076 VCTIHQPSIDIFEAFDE 1092 VCTIHQPSIDIFEAFDE Sbjct 183 VCTIHQPSIDIFEAFDE 233 Score = 50.4 bits (119), Expect = 2e-06, Method: Composition-based stats. Identities = 25/74 (34%), Positives = 45/74 (61%), Gaps = 1/74 (1%) Frame = +3 Query 346 VRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTTFQIVKSLRQAIHILGGTAVIS 405 V G+S QRKR+T LV + +FMDE ++GLD+ +++++R + G T V + Sbjct 15 VDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDT-GRTVVCT 191 Query 406 LLQPAPETYDLFDD 419 + QP+ + ++ FD+ Sbjct 192 IHQPSIDIFEAFDE 233   I want to get back only the first target and that's why i changed the -evalue parameter into this : tblastn -query query.fasta -db plant_DB -out output-evalue -html -evalue 3.1 but the results are still the same. Any idea to filter them better ?   Thank you. ...

Viewing all articles
Browse latest Browse all 41826

Latest Images

Trending Articles